Comparison

Recombinant Pig Somatotropin(GH1)

Item no. CSB-EP009407PI(A4)-100
Manufacturer Cusabio
Amount 100 ug
Quantity options 1 mg 10 ug 100 ug 200 ug 20 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Specific against other
Host E.coli
Conjugate/Tag Myc, HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MAAGPRTSALLAFALLCLPWTREVGAFPAMPLSSL FANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSI QNAQAAFCFSETIPAPTGKDEAQQRSDVELLRFSL LLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKD LEEGIQALMRELEDGSPRAGQILKQTYDKFDTNLR SDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFV ESSCAF
Protein Family Somatotropin/prolactin family
Citations "Porcine growth hormone: molecular cloning of cDNA and expression in bacterial and mammalian cells."
Kato Y., Shimokawa N., Kato T., Hirai T., Yoshihama K., Kawai H., Hattori M.A., Ezashi T., Shimogori Y., Wakabayashi K.
Biochim. Biophys. Acta 1048:290-293(1990)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Growth hormone
Available
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
29.4 kDa
General Research Areas
Developmental Biology
Relevance
Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.
Expression Region
1-216aa
Protein Length
Full Length
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.
Subcellular Location
Secreted
Biological activity
Not Test
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close