Comparison

Recombinant Sheep Somatoliberin(GHRH)

Item no. CSB-EP009412SH-50
Manufacturer Cusabio
Amount 50 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag GST
Purity Greater than 90% as determined by SDS-PAGE.
Sequence YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERN QEQGAKVRL
Protein Family Glucagon family
Citations Growth hormone-releasing factor from ovine and caprine hypothalamus isolation, sequence analysis and total synthesis.Brazeau P., Boehlen P., Esch F., Ling N., Wehrenberg W.B., Guillemin R.Biochem. Biophys. Res. Commun. 125:606-614(1984)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Growth hormone-releasing factor ;GRFGrowth hormone-releasing hormone ;GHRH
Available
Manufacturer - Conjugate / Tag
N-terminal GST-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
32.1 kDa
Relevance
GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone.
Expression Region
1-44aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone.
Subcellular Location
Secreted
Gene Names
GHRH
Sequence Info
Full Length
Organism
Ovis aries (Sheep)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close