Recombinant Human Guanine nucleotide-binding protein subunit alpha-15(GNA15)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
Item no. CSB-EP009587HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
P30679
Gene Names
GNA15
Organism
Homo sapiens (Human)
AA Sequence
MARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQ KKQDRGELKLLLLGPGESGKSTFIKQMRIIHGAGY SEEERKGFRPLVYQNIFVSMRAMIEAMERLQIPFS RPESKHHASLVMSQDPYKVTTFEKRYAAAMQWLWR DAGIRAYYERRREFHLLDSAVYYLSHLERITEEGY VPTAQDVLRSRMPTTGINEYCFSVQKTNLRIVDVG GQKSERKKWIHCFENVIALIYLASLSEYDQCLEEN NQENRMKESLALFGTILELPWFKSTSVILFLNKTD ILEEKIPTSHLATYFPSFQGPKQDAEAAKRFILDM YTRMYTGCVDGPEGSKKGARSRRLFSHYTCATDTQ NIRKVFKDVRDSVLARYLDEINLL
Expression Region
1-374aa
Sequence Info
Full Length
Tag Info
N-terminal 6xHis-Trx-tagged
MW
60.6 kDa
Alternative Name(s)
Epididymis tissue protein Li 17E
Guanine nucleotide-binding protein subunit alpha-16
Relevance
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
Reference
"G alpha 16, a G protein alpha subunit specifically expressed in hematopoietic cells."
Amatruda T.T. III, Steele D.A., Slepak V.Z., Simon M.I.
Proc. Natl. Acad. Sci. U.S.A. 88:5587-5591(1991)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €204.88
Price: €204.88
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close