« Back
Home /
Recombinant Human Guanine nucleotide-binding protein subunit alpha-15(GNA15)

Recombinant Human Guanine nucleotide-binding protein subunit alpha-15(GNA15)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	10ug
Host	E.coli
Item no.	CSB-EP009587HU-10
Conjugate/Tag	TRX
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Signal Transduction
Uniprot ID	P30679
Gene Names	GNA15
Organism	Homo sapiens (Human)
AA Sequence	MARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQ KKQDRGELKLLLLGPGESGKSTFIKQMRIIHGAGY SEEERKGFRPLVYQNIFVSMRAMIEAMERLQIPFS RPESKHHASLVMSQDPYKVTTFEKRYAAAMQWLWR DAGIRAYYERRREFHLLDSAVYYLSHLERITEEGY VPTAQDVLRSRMPTTGINEYCFSVQKTNLRIVDVG GQKSERKKWIHCFENVIALIYLASLSEYDQCLEEN NQENRMKESLALFGTILELPWFKSTSVILFLNKTD ILEEKIPTSHLATYFPSFQGPKQDAEAAKRFILDM YTRMYTGCVDGPEGSKKGARSRRLFSHYTCATDTQ NIRKVFKDVRDSVLARYLDEINLL
Expression Region	1-374aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-Trx-tagged
MW	60.6 kDa
Alternative Name(s)	Epididymis tissue protein Li 17E Guanine nucleotide-binding protein subunit alpha-16
Relevance	Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
Reference	"G alpha 16, a G protein alpha subunit specifically expressed in hematopoietic cells." Amatruda T.T. III, Steele D.A., Slepak V.Z., Simon M.I. Proc. Natl. Acad. Sci. U.S.A. 88:5587-5591(1991)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
Protein Families	G-alpha family, G(q) subfamily
Tissue Specificity	Specifically expressed in hematopoietic cells. Expressed in epididymis (at protein level).
Paythway	Calciumsignalingpathway
Tag Information	N-terminal 6xHis-Trx-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP009587HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time