« Back
Home /
Recombinant Mouse Platelet glycoprotein VI(Gp6),partial

Recombinant Mouse Platelet glycoprotein VI(Gp6),partial

Item no.	CSB-EP009689MO1-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	SUMO, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	QSGPLPKPSLQAQPSSLVPLGQSVILRCQGPPDVD LYRLEKLKPEKYEDQDFLFIPTMERSNAGRYRCSY QNGSHWSLPSDQLELIATGVYAKPSLSAHPSSAVP QGRDVTLKCQSPYSFDEFVLYKEGDTGSYKRPEKW YRANFPIITVTAAHSGTYRCYSFSSSSPYLWSAPS DPLVLVVTGLSATPSQVPTEESFPVTESSRRPSIL PTNKISTTEKPMNITASPEGLSPPFGFAHQHYAK
Citations	"The glycoprotein VI-phospholipase Cgamma2 signaling pathway controls thrombus formation induced by collagen and tissue factor in vitro and in vivo." Munnix I.C., Strehl A., Kuijpers M.J., Auger J.M., van der Meijden P.E., van Zandvoort M.A., oude Egbrink M.G., Nieswandt B., Heemskerk J.W. Arterioscler. Thromb. Vasc. Biol. 25:2673-2678(2005)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Glycoprotein 5
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	43.0 kDa
Relevance	Collagen receptor involved in collagen-induced platelet adhesion and activation. Plays a key role in platelet procoagulant activity and subsequent thrombin and fibrin formation. This procoagulant function may contribute to arterial and venous thrombus formation. The signaling pathway involves the FcR gamma-chain, the Src kinases (likely FYN or LYN) and SYK, the adapter protein LAT and leads to the activation of PLCG2.
Expression Region	22-265aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Collagen receptor involved in collagen-induced platelet adhesion and activation
Subcellular Location	Cell membrane, Single-pass membrane protein
Tissue Specificity	Megakaryocytes and platelets.
Gene Names	Gp6
Sequence Info	Extracellular Domain
Organism	Mus musculus (Mouse)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP009689MO1-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 10/23/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer