Comparison

Recombinant Human Glycophorin-A(GYPA),partial

Item no. CSB-EP010074HUa0-500
Manufacturer Cusabio
Amount 500 ug
Quantity options 1 mg 10 ug 100 ug 200 ug 20 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYA ATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSE PE
Citations Hsa, an adhesin of Streptococcus gordonii DL1, binds to alpha2-3-linked sialic acid on glycophorin A of the erythrocyte membrane.Yajima A., Urano-Tashiro Y., Shimazu K., Takashima E., Takahashi Y., Konishi K.Microbiol. Immunol. 52:69-77(2008)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias MN sialoglycoprotein;PAS-2Sialoglycoprotein alpha; CD235a
Available
Manufacturer - Targets
GYPA
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
12.0 kDa
General Research Areas
Cardiovascular
Relevance
Glycophorin A is the major intrinsic mbrane protein of the erythrocyte. The N-terminal glycosylated segment, which lies outside the erythrocyte mbrane, has MN blood group receptors. Appears to be important for the function of SLC4A1 and is required for high activity of SLC4A1. May be involved in translocation of SLC4A1 to the plasma mbrane. Is a receptor for influenza virus. Is a receptor for Plasmodium falciparum erythrocyte-binding antigen 175 (EBA-175); binding of EBA-175 is dependent on sialic acid residues of the O-linked glycans. Appears to be a receptor for Hepatitis A virus (HAV).
Expression Region
20-91aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Biologically active
Not Test
Protein length
Partial

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close