Comparison

Recombinant Mouse Granzyme A(Gzma)

Item no. CSB-EP010081MO-1
Manufacturer Cusabio
Amount 1 mg
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Host E.coli
Conjugate/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNW VLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKK AFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILH LPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREV NITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGG KDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWP GVYTFLSDKHLNWIKKIMKGSV
Protein Family Peptidase S1 family, Granzyme subfamily
Citations Genomic organization of the mouse granzyme A gene. Two mRNAs encode the same mature granzyme A with different leader peptides.
Hershberger R.J., Gershenfeld H.K., Weissman I.L., Su L.
J. Biol. Chem. 267:25488-25493(1992)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Autocrine thymic lymphoma granzyme-like serine protease,CTLA-3,Fragmentin-1,T cell-specific serine protease 1
Available
Manufacturer - Targets
Gzma
Manufacturer - Conjugate / Tag
N-terminal 6xHis-B2M-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
39.6 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Cell Biology
Relevance
Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent cell death with morphological features of apoptosis when delivered into the target cell through the immunological synapse. It cleaves after Lys or Arg. Cleaves APEX1 after 'Lys-31' and destroys its oxidative repair activity. Cleaves the nucleosome assembly protein SET after 'Lys-189', which disrupts its nucleosome assembly activity and allows the SET complex to translocate into the nucleus to nick and degrade the DNA
Expression Region
29-260aa
Protein Length
Full Length of Mature Protein
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent cell death with morphological features of apoptosis when delivered into the target cell through the immunological synapse. It cleaves after Lys or Arg. Cleaves APEX1 after 'Lys-31' and destroys its oxidative repair activity. Cleaves the nucleosome assembly protein SET after 'Lys-189', which disrupts its nucleosome assembly activity and allows the SET complex to translocate into the nucleus to nick and degrade the DNA (By similarity).
Subcellular Location
Secreted, Cytoplasmic granule
Tissue Specificity
Found in cytotoxic lymphocytes and in normal lymphoid tissues such as thymus and spleen.
Biological activity
Not Test
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close