Comparison

Recombinant Mouse Heterogeneous nuclear ribonucleoproteins A2/B1(Hnrnpa2b1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Item no. CSB-EP010602MOb3-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
O88569
Gene Names
Hnrnpa2b1
Organism
Mus musculus (Mouse)
AA Sequence
MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEE SLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFS SMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKP GAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDT IEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYH TINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFG DSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYN GYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQG GGYGGGYDNYGGGNYGSGSYNDFGNYNQQPSNYGP MKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGR SRY
Expression Region
1-353aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
MW
57.4 kDa
Alternative Name
hnRNP A2/B1
Relevance
Heterogeneous nuclear ribonucleoprotein (hnRNP) that associates with nascent pre-mRNAs, packaging them into hnRNP particles. The hnRNP particle arrangement on nascent hnRNA is non-random and sequence-dependent and serves to condense and stabilize the transcripts and minimize tangling and knotting. Packaging plays a role in various processes such as transcription, pre-mRNA processing, RNA nuclear export, subcellular location, mRNA translation and stability of mature mRNAs. Forms hnRNP particles with at least 20 other different hnRNP and heterogeneous nuclear RNA in the nucleus. Involved in transport of specific mRNAs to the cytoplasm in oligodendrocytes and neurons: acts by specifically recognizing and binding the A2RE (21 nucleotide hnRNP A2 response element) or the A2RE11 (derivative 11 nucleotide oligonucleotide) sequence motifs present on some mRNAs, and promotes their transport to the cytoplasm. Specifically binds single-stranded telomeric DNA sequences, protecting telomeric DNA repeat against endonuclease digestion. Also binds other RNA molecules, such as primary miRNA (pri-miRNAs): acts as a nuclear 'reader' of the N6-methyladenosine (m6A) mark by specifically recognizing and binding a subset of nuclear m6A-containing pri-miRNAs. Binding to m6A-containing pri-miRNAs promotes pri-miRNA processing by enhancing binding of DGCR8 to pri-miRNA transcripts. Involved in miRNA sorting into exosomes following sumoylation, possibly by binding (m6A)-containing pre-miRNAs. Acts as a regulator of efficiency of mRNA splicing, possibly by binding to m6A-containing pre-mRNAs
Reference
"Specific phosphopeptide enrichment with immobilized titanium ion affinity chromatography adsorbent for phosphoproteome analysis."
Zhou H., Ye M., Dong J., Han G., Jiang X., Wu R., Zou H.
J. Proteome Res. 7:3957-3967(2008)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 100ug
Available: In stock
Listprice: €495.78
Price: €495.78
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close