Comparison

Recombinant Human Heat shock protein HSP 90-alpha(HSP90AA1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Item no. CSB-EP010802HU1-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Neuroscience
Uniprot ID
P07900
Gene Names
HSP90AA1
Organism
Homo sapiens (Human)
AA Sequence
DQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEI FLRELISNSSDALDKIRYESLTDPSKLDSGKELHI NLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKS GTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKV TVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRG TKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPI TLFVEKERDKEVSD
Expression Region
9-232aa
Sequence Info
Partial
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
41.2 kDa
Alternative Name
Heat shock 86KDA ; HSP 86 ; HSP86Lipopolysaccharide-associated protein 2 ; LAP-2 ; LPS-associated protein 2Renal carcinoma antigen NY-REN-38
Relevance
Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function. Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion by monocytes.
Reference
The DNA sequence and analysis of human chromosome 14.Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.Nature 421:601-607(2003)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close