Comparison

Recombinant Human Islet cell autoantigen 1(ICA1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP010947HU(F1)-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
69 kDa islet cell autoantigen
Short name:
ICA69
Islet cell autoantigen p69
Short name:
ICAp69
Short name:
p69
AA Sequence
MSGHKCYPWDLQDRYAQDKSVVNKMQQKYWETKQA FIKATGKKEDEHVVASDADLDAKLELFHSIQRTCL DLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDK TRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEV ETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDV SQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMD VCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTS HTMAAIHESFKGYQPYEFTTLKSLQDPMKKLVEKE EKKKINQQESTDAAVQEPSQLISLEEENQRKESSS FKTEDGKSILSALDKGSTHTACSGPIDELLDMKSE EGACLGPVAGTPEPEGADKDDLLLLSEIFNASSLE EGEFSKEWAAVFGDGQVKEPVPTMALGEPDPKAQT GSGFLPSQLLDQNMKDLQASLQEPAKAASDLTAWF SLFADLDPLSNPDAVGKTDKEHELLNA
Research Topic
Neuroscience
Uniprot ID
Q05084
Gene Names
ICA1
Tag Info
N-terminal 6xHis-tagged
Expression Region
1-482aa
MW of Fusion Proten
58, 6
Sequence Info
Full Length of Isoform 3
Relevance
May play a role in neurotransmitter secretion.
Reference
"Islet cell autoantigen 69 kD (ICA69). Molecular cloning and characterization of a novel diabetes-associated autoantigen."Pietropaolo M., Castano L., Babu S., Buelow R., Kuo Y.-L.S., Martin S., Martin A., Powers A.C., Prochazka M., Naggert J., Leiter E.H., Eisenbarth G.S.J. Clin. Invest. 92:359-371(1993)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close