Comparison

Recombinant Human DNA-binding protein inhibitor ID-2(ID2)

Item no. CSB-EP010967HU-10
Manufacturer Cusabio
Amount 10 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSL LYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVID YILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTT LNTDISILSLQASEFPSELMSNDSKALCG
Citations An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Class B basic helix-loop-helix protein 26 ;bHLHb26Inhibitor of DNA binding 2Inhibitor of differentiation 2
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
30.9 kDa
General Research Areas
Epigenetics and Nuclear Signaling
Relevance
Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer. Restricts the CLOCK and ARNTL/BMAL1 localization to the cytoplasm. Plays a role in both the input and output pathways of the circadian clock: in the input component, is involved in modulating the magnitude of photic entrainment and in the output component, contributes to the regulation of a variety of liver clock-controlled genes involved in lipid metabolism.
Expression Region
1-134aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer. Restricts the CLOCK and ARNTL/BMAL1 localization to the cytoplasm. Plays a role in both the input and output pathways of the circadian clock
Subcellular Location
Cytoplasm, Nucleus
Tissue Specificity
Highly expressed in early fetal tissues, including those of the central nervous system.
Paythway
Hipposignalingpathway
Gene Names
ID2
Sequence Info
Full Length
Organism
Homo sapiens (Human)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close