Recombinant Rabbit Interleukin-2(IL2)

Manufacturer Cusabio
Category
Type Proteins
Specific against Rabbit
Amount 10ug
Host E.coli
Item no. CSB-EP011629RB-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
O77620
Gene Names
IL2
Organism
Oryctolagus cuniculus (Rabbit)
AA Sequence
APTSSSTKETQEQLDQLLLDLQVLLKGVNDYKNSK LSRMLTFKFYMPKKVTELKHLQCLEEELKPLEEVL NLAQGKNSHGGNTRESISNINVTVLKLKGSETFMC EYDETVTIVEFLNRWITFCQSIISASSS
Expression Region
21-153aa
Sequence Info
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
MW
19.1 kDa
Alternative Name(s)
T-cell growth factor
Short name:TCGF
Relevance
Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells.
Reference
"Cloning and sequence analysis of IL-2 gene in rabbit."Huang D., Yang G., Gu X., Wu K., Hao G.Submitted (JUL-2006)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €246.82
Price: €246.82
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close