Comparison

Recombinant Rabbit Interleukin-2(IL2)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP011629RB-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Alternative Name(s)
T-cell growth factor
Short name:TCGF
AA Sequence
APTSSSTKETQEQLDQLLLDLQVLLKGVNDYKNSK LSRMLTFKFYMPKKVTELKHLQCLEEELKPLEEVL NLAQGKNSHGGNTRESISNINVTVLKLKGSETFMC EYDETVTIVEFLNRWITFCQSIISASSS
Research Topic
Others
Uniprot ID
O77620
Gene Names
IL2
Tag Info
N-terminal 6xHis-tagged
Expression Region
21-153aa
MW of Fusion Proten
19, 1
Sequence Info
Full Length
Relevance
Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells.
Reference
"Cloning and sequence analysis of IL-2 gene in rabbit."Huang D., Yang G., Gu X., Wu K., Hao G.Submitted (JUL-2006)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Oryctolagus cuniculus (Rabbit)
Amount: 10ug
Available: In stock
Listprice: €246.81
Price: €246.81
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close