« Back
Home /
Recombinant Mouse Interleukin-2 receptor subunit beta(Il2rb),partial

Recombinant Mouse Interleukin-2 receptor subunit beta(Il2rb),partial

Item no.	CSB-EP011650MO-100
Manufacturer	Cusabio
Amount	100 ug
Quantity options	1 mg 10 ug 100 ug 200 ug 50 ug 500 ug
Category	Oncology Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins By Organ Lung Cancer Skin Cancer Lymphatic System Cancer
Type	Proteins Recombinant
Specific against	other
Host	E.coli
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	ASAAVKNCSHLECFYNSRANVSCMWSHEEALNVTT CHVHAKSNLRHWNKTCELTLVRQASWACNLILGSF PESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPF DNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIE PYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEM LIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTR PADPMKE
Protein Family	Type I cytokine receptor family, Type 4 subfamily
Citations	Murine interleukin 2 receptor beta chain dysregulated gene expression in lymphoma line EL-4 caused by a promoter insertion.Kono T., Doi T., Yamada G., Hatakeyama M., Minamoto S., Tsudo M., Miyasaka M., Miyata T., Taniguchi T.Proc. Natl. Acad. Sci. U.S.A. 87:1806-1810(1990)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	High affinity IL-2 receptor subunit betap70-75,CD122
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	29.3 kDa
Buffer	Tris-based buffer, 50% glycerol
Relevance	Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.
Expression Region	24-240aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.
Subcellular Location	Membrane, Single-pass type I membrane protein
Gene Names	l2rb
Sequence Info	Extracellular Domain
Organism	Mus musculus (Mouse)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 2/12/2026

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer