« Back
Home /
Recombinant Mouse Interleukin-7 receptor subunit alpha(Il7r),partial

Recombinant Mouse Interleukin-7 receptor subunit alpha(Il7r),partial

Manufacturer	Cusabio
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Lung Cancer
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	10ug
Host	E.coli
Item no.	CSB-EP011670MO-10
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Immunology
Uniprot ID	P16872
Gene Names	Il7r
Organism	Mus musculus (Mouse)
AA Sequence	ESGNAQDGDLEDADADDHSFWCHSQLEVDGSQHLL TCAFNDSDINTANLEFQICGALLRVKCLTLNKLQD IYFIKTSEFLLIGSSNICVKLGQKNLTCKNMAINT IVKAEAPSDLKVVYRKEANDFLVTFNAPHLKKKYL KKVKHDVAYRPARGESNWTHVSLFHTRTTIPQRKL RPKAMYEIKVRSIPHNDYFKGFWSEWSPSSTFETP EPKNQGGWD
Expression Region	21-239aa
Sequence Info	Extracellular Domain
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	41 kDa
Alternative Name(s)	Short name: IL-7 receptor subunit alpha Short name: IL-7R subunit alpha Short name: IL-7R-alpha Short name: IL-7RA
Relevance	Receptor for interleukin-7. Also acts as a receptor for thymic stromal lymphopoietin (TSLP).
Reference	"Structural basis of the proinflammatory signaling complex mediated by TSLP."Verstraete K., van Schie L., Vyncke L., Bloch Y., Tavernier J., Pauwels E., Peelman F., Savvides S.N.Nat. Struct. Mol. Biol. 21:375-382(2014)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Receptor for interleukin-7. Also acts as a receptor for thymic stromal lymphopoietin (TSLP).
Subcellular Location	Membrane, Single-pass type I membrane protein
Protein Families	Type I cytokine receptor family, Type 4 subfamily
Tissue Specificity	Spleen, thymus and fetal liver.
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP011670MO-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time