« Back
Home /
Recombinant Rat Glandular kallikrein-7, submandibular/renal(Klk7)

Recombinant Rat Glandular kallikrein-7, submandibular/renal(Klk7)

Item no.	CSB-EP012458RA-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	VIGGYKCEKNSQPWQVALYSFTKYLCGGVLIDPSW VITAAHCSSNNYQVWLGRNNLLEDEPFAQHRLVSQ SFPHPDYKPFLMRNHTRKPGDDHSNDLMLLHLSQP ADITDGVKVIDLPTEEPKVGSTCLASGWGSTKPLI WEFPDDLQCVNIHLLSNEKCIKAYKEKVTDLMLCA GELEGGKDTCTGDSGGPLLCDGVLQGITSWGSVPC AKTNMPAIYTKLIKFTSWIKEVMKENP
Protein Family	Peptidase S1 family, Kallikrein subfamily
Citations	The expression of two kallikrein gene family members in the rat kidney.Brady J.M., MacDonald R.J.Arch. Biochem. Biophys. 278:342-349(1990)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Esterase BKallikrein-related protein K1;Proteinase ARSKG-7Tissue kallikrein
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	30.3 kDa
Relevance	Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. Predominant kallikrein protein in the kidney.
Expression Region	25-261aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. Predominant kallikrein protein in the kidney.
Tissue Specificity	Kidney and submandibular gland. Not expressed in liver, pancreas, spleen, parotid, testis, cortex, prostate, ovary and pituitary.
Gene Names	Klk7
Sequence Info	Full Length of Mature Protein
Organism	Rattus norvegicus (Rat)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP012458RA-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer