Comparison

Recombinant Human Kynurenine 3-monooxygenase(KMO)

Item no. CSB-EP012475HUb0-100
Manufacturer Cusabio
Amount 100 ug
Quantity options 1 mg 10 ug 100 ug 200 ug 20 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MDSSVIQRKKVAVIGGGLVGSLQACFLAKRNFQID VYEAREDTRVATFTRGRSINLALSHRGRQALKAVG LEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQY ILSVSRENLNKDLLTAAEKYPNVKMHFNHRLLKCN PEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRS HLMKKPRFDYSQQYIPHGYMELTIPPKNGDYAMEP NYLHIWPRNTFMMIALPNMNKSFTCTLFMPFEEFE KLL
Protein Family Aromatic-ring hydroxylase family, KMO subfamily
Citations "Structural and mechanistic basis of differentiated inhibitors of the acute pancreatitis target kynurenine-3-monooxygenase."
Hutchinson J.P., Rowland P., Taylor M.R.D., Christodoulou E.M., Haslam C., Hobbs C.I., Holmes D.S., Homes P., Liddle J., Mole D.J., Uings I., Walker A.L., Webster S.P., Mowat C.G., Chung C.W.
Nat. Commun. 8:15827-15827(2017)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Kynurenine 3-hydroxylase
Available
Manufacturer - Targets
KMO
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
61.9 kDa
General Research Areas
Metabolism
Relevance
Catalyzes the hydroxylation of L-kynurenine to form 3-hydroxy-L-kynurenine. Required for synthesis of quinolinic acid, a neurotoxic NMDA receptor antagonist and potential endogenous inhibitor of NMDA receptor signaling in axonal targeting, synaptogenesis and apoptosis during brain development. Quinolinic acid may also affect NMDA receptor signaling in pancreatic beta cells, osteoblasts, myocardial cells, and the gastrointestinal tract.
Expression Region
1-486aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Catalyzes the hydroxylation of L-kynurenine (L-Kyn) to form 3-hydroxy-L-kynurenine (L-3OHKyn). Required for synthesis of quinolinic acid, a neurotoxic NMDA receptor antagonist and potential endogenous inhibitor of NMDA receptor signaling in axonal targeting, synaptogenesis and apoptosis during brain development. Quinolinic acid may also affect NMDA receptor signaling in pancreatic beta cells, osteoblasts, myocardial cells, and the gastrointestinal tract.
Subcellular Location
Mitochondrion outer membrane, Multi-pass membrane protein
Tissue Specificity
Highest levels in placenta and liver. Detectable in kidney.
Biologically active
Not Test
Protein length
Full Length

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Delivery expected until 8/28/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close