« Back
Home /
Recombinant Human Keratin, type II cytoskeletal 7(KRT7)

Recombinant Human Keratin, type II cytoskeletal 7(KRT7)

Item no.	CSB-EP012564HU-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGS SSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQS LLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFI DKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIF EAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDF KNKYEDEINHRTAAENEFVVLKKDVDAAYMSKVEL EAKVDALNDEINFLRTLNETELTELQSQISDTSVV LSM
Protein Family	Intermediate filament family
Citations	"Sequence and expression of a human type II mesothelial keratin."Glass C., Kim K.H., Fuchs E.J. Cell Biol. 101:2366-2373(1985)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cytokeratin-7; Short name:; CK-7; Keratin-7; Short name:; K7; Sarcolectin; Type-II keratin Kb7
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	67.3 kDa
General Research Areas	Signal Transduction
Relevance	Blocks interferon-dependent interphase and stimulates DNA synthesis in cells. Involved in the translational regulation of the human papillomavirus type 16 E7 mRNA (HPV16 E7).
Expression Region	2-469aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Blocks interferon-dependent interphase and stimulates DNA synthesis in cells. Involved in the translational regulation of the human papillomavirus type 16 E7 mRNA (HPV16 E7).
Subcellular Location	Cytoplasm
Tissue Specificity	Expressed in cultured epidermal, bronchial and mesothelial cells but absent in colon, ectocervix and liver. Observed throughout the glandular cells in the junction between stomach and esophagus but is absent in the esophagus.
Gene Names	KRT7
Sequence Info	Full Length of Mature Protein
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP012564HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 8/28/2025

Compare

Add to wishlist

Get an offer

Request delivery time