Comparison

Recombinant Human Lymphocyte-specific protein 1(LSP1)

Item no. CSB-EP013214HU-500
Manufacturer Cusabio
Amount 500 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Specific against other
Host E.coli
Conjugate/Tag GST
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MAEASSDPGAEEREELLGPTAQWSVEDEEEAVHEQ CQHERDRQLQAQDEEGGGHVPERPKQEMLLSLKPS EAPELDEDEGFGDWSQRPEQRQQHEGAQGTLDSGE PPQCRSPEGEQEDRPGLHAYEKEDSDEVHLEELSL SKEGPGPEDTVQDNLGAAGAEEEQEEHQKCQQPRT PSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIE KSNSVKKSQPDLPISKIDQWLEQYTQAIETAGRTP KLA
Citations "Human and mouse LSP1 genes code for highly conserved phosphoproteins."
Jongstra-Bilen J., Young A.J., Chong R., Jongstra J.
J. Immunol. 144:1104-1110(1990)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias 47KDA actin-binding protein,52KDA phosphoprotein
Available
Manufacturer - Conjugate / Tag
N-terminal GST-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
64.2 kDa
Buffer
Tris-based buffer, 50% glycerol
General Research Areas
Immunology
Relevance
May play a role in mediating neutrophil activation and chemotaxis.
Expression Region
1-339aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
May play a role in mediating neutrophil activation and chemotaxis.
Subcellular Location
Cell membrane, Peripheral membrane protein, Cytoplasmic side
Tissue Specificity
Activated T-lymphocytes.
Gene Names
LSP1
Sequence Info
Full Length of BC001785
Organism
Homo sapiens (Human)
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close