« Back
Home /
Recombinant Human Mitogen-activated protein kinase 6(MAPK6)

Recombinant Human Mitogen-activated protein kinase 6(MAPK6)

Item no.	CSB-EP013458HU-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Neuroscience Neural Lineage Markers Targets for Rodent Neurosciences Neural Signaling Peptides & Proteins Recombinant Proteins Glial Cell Markers
Type	Proteins Recombinant
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVF SAVDNDCDKRVAIKKIVLTDPQSVKHALREIKIIR RLDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVY IVQEYMETDLANVLEQGPLLEEHARLFMYQLLRGL KYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLA RIMDPHYSHKGHLSEGLVTKWYRSPRLLLSPNNYT KAIDMWAAGCIFAEMLTGKTLFAGAHELEQMQLIL ESI
Protein Family	Protein kinase superfamily, CMGC Ser/Thr protein kinase family, MAP kinase subfamily
Citations	Identification and proteomic analysis of distinct UBE3A/E6AP protein complexes.Martinez-Noel G., Galligan J.T., Sowa M.E., Arndt V., Overton T.M., Harper J.W., Howley P.M.Mol. Cell. Biol. 32:3095-3106(2012)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Extracellular domain signal-regulated kinase 3 ,ERK-3MAP kinase isoform p97 ,p97-MAPK
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	98.7 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Signal Transduction
Relevance	Atypical MAPK protein. Phosphorylates microtubule-associated protein 2 (MAP2) and MAPKAPK5. The precise role of the complex formed with MAPKAPK5 is still unclear, but the complex follows a complex set of phosphorylation events: upon interaction with atypical MAPKAPK5, ERK3/MAPK6 is phosphorylated at Ser-189 and then mediates phosphorylation and activation of MAPKAPK5, which in turn phosphorylates ERK3/MAPK6. May promote entry in the cell cycle .
Expression Region	1-721aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Atypical MAPK protein. Phosphorylates microtubule-associated protein 2 (MAP2) and MAPKAPK5. The precise role of the complex formed with MAPKAPK5 is still unclear, but the complex follows a complex set of phosphorylation events
Subcellular Location	Cytoplasm, Nucleus
Tissue Specificity	Highest expression in the skeletal muscle, followed by the brain. Also found in heart, placenta, lung, liver, pancreas, kidney and skin fibroblasts.
Pathway	IL-17signalingpathway
Gene Names	MAPK6
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP013458HU-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 12/4/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer