« Back
Home /
Recombinant Human Collagenase 3(MMP13)

Recombinant Human Collagenase 3(MMP13)

Manufacturer	Cusabio
Category	Oncology Neuroscience Neuroinflammation Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins By Organ Colorectal Cancer
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	10ug
Host	E.coli
Item no.	CSB-EP014660HU-10
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research areas	Developmental Biology
Target / Protein	MMP13
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P45452
AA Sequence	YNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAF KKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHG DFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWT SSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPI YTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHP KTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHP QQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFI FRGRKFWALNGYDILEGYPKKISELGLPKEVKKIS AAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPR LIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYS IWSNRIVRVMPANSILWC
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	104-471aa
Protein length	Full Length of Mature Protein
MW	58.3 kDa
Alternative Name(s)	Matrix metalloproteinase-13 ; MMP-13
Relevance	Plays a role in the degradation of Extracellular domain matrix proteins including fibrillar collagen, fibronectin, TNC and ACAN. Cleaves triple helical collagens, including type I, type II and type III collagen, but has the highest activity with soluble type II collagen. Can also degrade collagen type IV, type XIV and type X. May also function by activating or degrading key regulatory proteins, such as TGFB1 and CTGF. Plays a role in wound healing, tissue rodeling, cartilage degradation, bone development, bone mineralization and ossification. Required for normal bryonic bone development and ossification. Plays a role in the healing of bone fractures via endochondral ossification. Plays a role in wound healing, probably by a mechanism that involves proteolytic activation of TGFB1 and degradation of CTGF. Plays a role in keratinocyte migration during wound healing. May play a role in cell migration and in tumor cell invasion.
References	A secreted tyrosine kinase acts in the Extracellular domain environment.Bordoli M.R., Yum J., Breitkopf S.B., Thon J.N., Italiano J.E. Jr., Xiao J., Worby C., Wong S.K., Lin G., Edenius M., Keller T.L., Asara J.M., Dixon J.E., Yeo C.Y., Whitman M.Cell 158:1033-1044(2014)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plays a role in the degradation of extracellular matrix proteins including fibrillar collagen, fibronectin, TNC and ACAN. Cleaves triple helical collagens, including type I, type II and type III collagen, but has the highest activity with soluble type II collagen. Can also degrade collagen type IV, type XIV and type X. May also function by activating or degrading key regulatory proteins, such as TGFB1 and CTGF. Plays a role in wound healing, tissue remodeling, cartilage degradation, bone development, bone mineralization and ossification. Required for normal embryonic bone development and ossification. Plays a role in the healing of bone fractures via endochondral ossification. Plays a role in wound healing, probably by a mechanism that involves proteolytic activation of TGFB1 and degradation of CTGF. Plays a role in keratinocyte migration during wound healing. May play a role in cell migration and in tumor cell invasion.
Involvement in disease	Spondyloepimetaphyseal dysplasia Missouri type (SEMD-MO); Metaphyseal anadysplasia 1 (MANDP1); Metaphyseal dysplasia, Spahr type (MDST)
Subcellular Location	Secreted, extracellular space, extracellular matrix, Secreted
Protein Families	Peptidase M10A family
Tissue Specificity	Detected in fetal cartilage and calvaria, in chondrocytes of hypertrophic cartilage in vertebrae and in the dorsal end of ribs undergoing ossification, as well as in osteoblasts and periosteal cells below the inner periosteal region of ossified ribs. Detected in chondrocytes from in joint cartilage that have been treated with TNF and IL1B, but not in untreated chondrocytes. Detected in T lymphocytes. Detected in breast carcinoma tissue.
Paythway	IL-17signalingpathway
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP014660HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time