Comparison

Recombinant Human Collagenase 3(MMP13)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP014660HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Matrix metalloproteinase-13 ; MMP-13
AA Sequence
YNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAF KKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHG DFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWT SSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPI YTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHP KTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHP QQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFI FRGRKFWALNGYDILEGYPKKISELGLPKEVKKIS AAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPR LIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYS IWSNRIVRVMPANSILWC
Research Topic
Developmental Biology
Uniprot ID
P45452
Gene Names
MMP13
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
104-471aa
MW of Fusion Proten
58, 3
Sequence Info
Full Length
Relevance
Plays a role in the degradation of Extracellular domain matrix proteins including fibrillar collagen, fibronectin, TNC and ACAN. Cleaves triple helical collagens, including type I, type II and type III collagen, but has the highest activity with soluble type II collagen. Can also degrade collagen type IV, type XIV and type X. May also function by activating or degrading key regulatory proteins, such as TGFB1 and CTGF. Plays a role in wound healing, tissue rodeling, cartilage degradation, bone development, bone mineralization and ossification. Required for normal bryonic bone development and ossification. Plays a role in the healing of bone fractures via endochondral ossification. Plays a role in wound healing, probably by a mechanism that involves proteolytic activation of TGFB1 and degradation of CTGF. Plays a role in keratinocyte migration during wound healing. May play a role in cell migration and in tumor cell invasion.
Reference
A secreted tyrosine kinase acts in the Extracellular domain environment.Bordoli M.R., Yum J., Breitkopf S.B., Thon J.N., Italiano J.E. Jr., Xiao J., Worby C., Wong S.K., Lin G., Edenius M., Keller T.L., Asara J.M., Dixon J.E., Yeo C.Y., Whitman M.Cell 158:1033-1044(2014)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close