Comparison

Recombinant Human Thrombopoietin receptor(MPL),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP014755HU-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Immunology
Uniprot ID
P40238
Gene Names
MPL
Organism
Homo sapiens (Human)
AA Sequence
QDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPS GTYQLLYAYPREKPRACPLSSQSMPHFGTRYVCQF PDQEEVRLFFPLHLWVKNVFLNQTRTQRVLFVDSV GLPAPPSIIKAMGGSQPGELQISWEEPAPEISDFL RYELRYGPRDPKNSTGPTVIQLIATETCCPALQRP HSASALDQSPCAQPTMPWQDGPKQTSPSREASALT AEGGSCLISGLQPGNSYWLQLRSEPDGISLGGSWG SWSLPVTVDLPGDAVALGLQCFTLDLKNVTCQWQQ QDHASSQGFFYHSRARCCPRDRYPIWENCEEEEKT NPGLQTPQFSRCHFKSRNDSIIHILVEVTTAPGTV HSYLGSPFWIHQAVRLPTPNLHWREISSGHLELEW QHPSSWAAQETCYQLRYTGEGHQDWKVLEPPLGAR GGTLELRPRSRYRLQLRARLNGPTYQGPWSSWSDP TRVETATETAW
Expression Region
26-491aa
Sequence Info
Extracellular Domain
Source
E.coli
Tag Info
N-terminal 6xHis-tagged
MW
56.5 kDa
Alternative Name
Myeloproliferative leukemia protein. Proto-oncogene c-Mpl. CD110
Relevance
Receptor for thrombopoietin. May represent a regulatory molecule specific for TPO-R-dependent immune responses.
Reference
The DNA sequence and biological annotation of human chromosome 1.Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.Nature 441:315-321(2006)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Receptor for thrombopoietin. May represent a regulatory molecule specific for TPO-R-dependent immune responses.
Involvement in disease
Congenital amegakaryocytic thrombocytopenia (CAMT); Thrombocythemia 2 (THCYT2); Myelofibrosis with myeloid metaplasia (MMM)
Subcellular Location
Cell membrane, Single-pass type I membrane protein, Golgi apparatus, Cell surface
Protein Families
Type I cytokine receptor family, Type 1 subfamily
Tissue Specificity
Expressed at a low level in a large number of cells of hematopoietic origin. Isoform 1 and isoform 2 are always found to be coexpressed.
Paythway
Jak-STATsignalingpathway
Amount: 10ug
Available: In stock
Listprice: €175.45
Price: €175.45
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close