Comparison

Recombinant Human Protein Mpv17(MPV17)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP014771HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQ QLVERRGLQEHQRGRTLTMVSLGCGFVGPVVGGWY KVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFL PLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPA VQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHR
Research Topic
Metabolism
Uniprot ID
P39210
Gene Names
MPV17
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-176aa
MW of Fusion Proten
35, 7
Sequence Info
Full Length
Relevance
Involved in mitochondria homeostasis. May be involved in the metabolism of reactive oxygen species and control of oxidative phosphorylation and mitochondrial DNA (mtDNA) maintenance.
Reference
Identification of rare DNA variants in mitochondrial disorders with improved array-based sequencing.Wang W., Shen P., Thiyagarajan S., Lin S., Palm C., Horvath R., Klopstock T., Cutler D., Pique L., Schrijver I., Davis R.W., Mindrinos M., Speed T.P., Scharfe C.Nucleic Acids Res. 39:44-58(2011)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close