« Back
Home /
Recombinant Human Protein Mpv17(MPV17)

Recombinant Human Protein Mpv17(MPV17)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	10ug
Host	E.coli
Item no.	CSB-EP014771HU-10
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Metabolism
Uniprot ID	P39210
Gene Names	MPV17
Organism	Homo sapiens (Human)
AA Sequence	MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQ QLVERRGLQEHQRGRTLTMVSLGCGFVGPVVGGWY KVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFL PLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPA VQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHR
Expression Region	1-176aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	35.7 kDa
Relevance	Involved in mitochondria homeostasis. May be involved in the metabolism of reactive oxygen species and control of oxidative phosphorylation and mitochondrial DNA (mtDNA) maintenance.
Reference	Identification of rare DNA variants in mitochondrial disorders with improved array-based sequencing.Wang W., Shen P., Thiyagarajan S., Lin S., Palm C., Horvath R., Klopstock T., Cutler D., Pique L., Schrijver I., Davis R.W., Mindrinos M., Speed T.P., Scharfe C.Nucleic Acids Res. 39:44-58(2011)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in mitochondria homeostasis. May be involved in the metabolism of reactive oxygen species and control of oxidative phosphorylation and mitochondrial DNA (mtDNA) maintenance.
Involvement in disease	Mitochondrial DNA depletion syndrome 6 (MTDPS6)
Subcellular Location	Mitochondrion inner membrane, Multi-pass membrane protein
Protein Families	Peroxisomal membrane protein PXMP2/4 family
Tissue Specificity	Ubiquitous. Expressed in pancreas, kidney, muscle, liver, lung, placenta, brain and heart.
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP014771HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time