Comparison

Recombinant Human Macrophage mannose receptor 1(MRC1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP014783HU-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Immunology
Uniprot ID
P22897
Gene Names
MRC1
Organism
Homo sapiens (Human)
AA Sequence
RTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLAS INNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSE GFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGD PTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQ DNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCK RNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGL LISLDKKFAWMDGSKVDYVSWATGEPNFANEDENC VTMYSNSGFWNDINCGYPNAFICQRHNSSINATTV MPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKN WQEARKACIGFGGNLVSIQNEKEQAFLTYHMKDST FSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPG GRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSK RGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSL MRQKFQWHEAETYCKLHNSLIASILDPYSNAFAWL QMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNW AADEPKLKSACVYLDLDGYWKTAHCNESFYFLCK
Expression Region
655-1213aa
Sequence Info
Partial
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
80.4 kDa
Alternative Name
C-type lectin domain family 13 member DC-type lectin domain family 13 member D-like. Macrophage mannose receptor 1-like protein 1. CD206
Relevance
Mediates the endocytosis of glycoproteins by macrophages. Binds both sulfated and non-sulfated polysaccharide chains. Acts as phagocytic receptor for bacteria, fungi and other pathogens.
Reference
An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Mediates the endocytosis of glycoproteins by macrophages. Binds both sulfated and non-sulfated polysaccharide chains.; FUNCTION
Subcellular Location
Endosome membrane, Single-pass type I membrane protein, Cell membrane, Single-pass type I membrane protein
Amount: 10ug
Available: In stock
Listprice: €175.45
Price: €175.45
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close