Comparison

Recombinant Human Macrophage mannose receptor 1(MRC1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP014783HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
C-type lectin domain family 13 member DC-type lectin domain family 13 member D-like; Macrophage mannose receptor 1-like protein 1; CD206
AA Sequence
RTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLAS INNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSE GFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGD PTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQ DNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCK RNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGL LISLDKKFAWMDGSKVDYVSWATGEPNFANEDENC VTMYSNSGFWNDINCGYPNAFICQRHNSSINATTV MPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKN WQEARKACIGFGGNLVSIQNEKEQAFLTYHMKDST FSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPG GRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSK RGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSL MRQKFQWHEAETYCKLHNSLIASILDPYSNAFAWL QMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNW AADEPKLKSACVYLDLDGYWKTAHCNESFYFLCK
Research Topic
Immunology
Uniprot ID
P22897
Gene Names
MRC1
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
655-1213aa
MW of Fusion Proten
80, 4
Sequence Info
Partial
Relevance
Mediates the endocytosis of glycoproteins by macrophages. Binds both sulfated and non-sulfated polysaccharide chains. Acts as phagocytic receptor for bacteria, fungi and other pathogens.
Reference
An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close