« Back
Home /
Recombinant Human Metaxin-2(MTX2)

Recombinant Human Metaxin-2(MTX2)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	10ug
Host	E.coli
Item no.	CSB-EP015213HU-10
Conjugate/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Tags & Cell Markers
Uniprot ID	O75431
Gene Names	MTX2
Organism	Homo sapiens (Human)
AA Sequence	MSLVAEAFVSQIAAAEPWPENATLYQQLKGEQILL SDNAASLAVQAFLQMCNLPIKVVCRANAEYMSPSG KVPFIHVGNQVVSELGPIVQFVKAKGHSLSDGLEE VQKAEMKAYMELVNNMLLTAELYLQWCDEATVGEI THARYGSPYPWPLNHILAYQKQWEVKRKMKAIGWG KKTLDQVLEDVDQCCQALSQRLGTQPYFFNKQPTE LDALVFGHLYTILTTQLTNDELSEKVKNYSNLLAF CRRIEQHYFEDRGKGRLS
Expression Region	1-263aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	56.8 kDa
Alternative Name(s)	Mitochondrial outer membrane import complex protein 2
Relevance	Involved in transport of proteins into the mitochondrion.
Reference	"Metaxin 1 interacts with metaxin 2, a novel related protein associated with the mammalian mitochondrial outer membrane." Armstrong L.C., Saenz A.J., Bornstein P. J. Cell. Biochem. 74:11-22(1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in transport of proteins into the mitochondrion.
Subcellular Location	Mitochondrion outer membrane, Mitochondrion
Protein Families	Metaxin family
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time