Comparison

Recombinant Human Metaxin-2(MTX2)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP015213HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Mitochondrial outer membrane import complex protein 2
AA Sequence
MSLVAEAFVSQIAAAEPWPENATLYQQLKGEQILL SDNAASLAVQAFLQMCNLPIKVVCRANAEYMSPSG KVPFIHVGNQVVSELGPIVQFVKAKGHSLSDGLEE VQKAEMKAYMELVNNMLLTAELYLQWCDEATVGEI THARYGSPYPWPLNHILAYQKQWEVKRKMKAIGWG KKTLDQVLEDVDQCCQALSQRLGTQPYFFNKQPTE LDALVFGHLYTILTTQLTNDELSEKVKNYSNLLAF CRRIEQHYFEDRGKGRLS
Research Topic
Tags & Cell Markers
Uniprot ID
O75431
Gene Names
MTX2
Tag Info
N-terminal GST-tagged
Expression Region
1-263aa
MW of Fusion Proten
56, 8
Sequence Info
Full Length
Relevance
Involved in transport of proteins into the mitochondrion.
Reference
"Metaxin 1 interacts with metaxin 2, a novel related protein associated with the mammalian mitochondrial outer membrane."
Armstrong L.C., Saenz A.J., Bornstein P.
J. Cell. Biochem. 74:11-22(1999)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €204.88
Price: €204.88
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close