Recombinant Human Metaxin-2(MTX2)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
Item no. CSB-EP015213HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Tags & Cell Markers
Uniprot ID
O75431
Gene Names
MTX2
Organism
Homo sapiens (Human)
AA Sequence
MSLVAEAFVSQIAAAEPWPENATLYQQLKGEQILL SDNAASLAVQAFLQMCNLPIKVVCRANAEYMSPSG KVPFIHVGNQVVSELGPIVQFVKAKGHSLSDGLEE VQKAEMKAYMELVNNMLLTAELYLQWCDEATVGEI THARYGSPYPWPLNHILAYQKQWEVKRKMKAIGWG KKTLDQVLEDVDQCCQALSQRLGTQPYFFNKQPTE LDALVFGHLYTILTTQLTNDELSEKVKNYSNLLAF CRRIEQHYFEDRGKGRLS
Expression Region
1-263aa
Sequence Info
Full Length
Tag Info
N-terminal GST-tagged
MW
56.8 kDa
Alternative Name(s)
Mitochondrial outer membrane import complex protein 2
Relevance
Involved in transport of proteins into the mitochondrion.
Reference
"Metaxin 1 interacts with metaxin 2, a novel related protein associated with the mammalian mitochondrial outer membrane."
Armstrong L.C., Saenz A.J., Bornstein P.
J. Cell. Biochem. 74:11-22(1999)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €204.88
Price: €204.88
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close