Comparison

Recombinant Human Myelin expression factor 2(MYEF2),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP015283HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
MST156
AA Sequence
GGMNRIGGGIGFGGLEAMNSMGGFGGVGRMGELYR GAMTSSMERDFGRGDIGINQGFGDSFGRLGSAMIG GFAGRIGSSNMGPVGSGISGGMGSMNSVTGGMGMG LDRMSSSFDRMGPGIGAILERSIDMDRGFLSGPMG SGMRERIGSKGNQIFVRNLPFDLTWQKLKEKFSQC GHVMFAEIKMENGKSKGCGTVRFDSPESAE
Research Topic
Transcription
Uniprot ID
Q9P2K5
Gene Names
MYEF2
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
372-576aa
MW of Fusion Proten
37, 3
Sequence Info
Partial
Relevance
Transcriptional repressor of the myelin basic protein gene (MBP). Binds to the proximal MB1 elent 5'-TTGTCC-3' of the MBP promoter. Its binding to MB1 and function are inhibited by PURA .
Reference
An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close