« Back
Home /
Recombinant Human Neural cell adhesion molecule 1(NCAM1),partial

Recombinant Human Neural cell adhesion molecule 1(NCAM1),partial

Item no.	CSB-EP015511HU1-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 200 ug 20 ug 50 ug 500 ug
Category	Oncology Neuroscience Neuroinflammation Molecular Targets for Neuroscience Neural Adhesion Molecules Peptides & Proteins Recombinant Proteins By Organ Lung Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Human (Homo sapiens)
Host	E.coli
Conjugate/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	ISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPN QQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTG EDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDA VIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLS NNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQ VIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGF PEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIK KVD
Citations	Splicing of the VASE exon of neural cell adhesion molecule (NCAM) in human small-cell lung carcinoma (SCLC). van Duijnhoven H.L., Helfrich W., de Leij L., Roebroek A.J., van de Ven W.J., Healey K., Culverwell A., Rossell R.J., Kemshead J.T., Patel K. Int. J. Cancer 50:118-123(1992)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD_antigen: CD56; NCAM
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	75.9 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Neuroscience
Relevance	This protein is a cell adhesion molecule involved in neuron-neuron adhesion, neurite fasciculation, outgrowth of neurites, etc. (Microbial infection) Acts as a receptor for rabies virus.
Biologically Active	Not Test
Expression Region	31-677aa
Protein Length	Partial of isform 2
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	This protein is a cell adhesion molecule involved in neuron-neuron adhesion, neurite fasciculation, outgrowth of neurites, etc.; FUNCTION
Subcellular Location	Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 3: Cell membrane, Lipid-anchor, GPI-anchor, SUBCELLULAR LOCATION: Isoform 4: Cell membrane, Lipid-anchor, GPI-anchor, SUBCELLULAR LOCATION: Isoform 5: Secreted, SUBCELLULAR LOCATION: Isoform 6: Secreted

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP015511HU1-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer