Comparison

Recombinant Human Cytoplasmic domain protein NCK2(NCK2)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP015531HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Growth factor receptor-bound protein 4NCK adaptor protein 2 ; Nck-2SH2/SH3 adaptor protein NCK-beta
AA Sequence
MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDS KTWWRVRNAANRTGYVPSNYVERKNSLKKGSLVKN LKDTLGLGKTRRKTSARDASPTPSTDAEYPANGSG ADRIYDLNIPAFVKFAYVAEREDELSLVKGSRVTV MEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAE SPSFLSLRKGASLSNGQGSRVLHVVQTLYPFSSVT EEELNFEKGETMEVIEKPENDPEWWKCKNARGQVG LVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRF AGREWYYGNVTRHQAECALNERGVEGDFLIRDSES SPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFH TMDELVEHYKKAPIFTSEHGEKLYLVRALQ
Research Topic
Transcription
Uniprot ID
O43639
Gene Names
NCK2
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-380aa
MW of Fusion Proten
58, 9
Sequence Info
Full Length
Relevance
Adapter protein which associates with tyrosine-phosphorylated growth factor receptors or their cellular substrates. Maintains low levels of EIF2S1 phosphorylation by promoting its dephosphorylation by PP1. Plays a role in ELK1-dependent transcriptional activation in response to activated Ras signaling.
Reference
Identification of Nck family genes, chromosomal localization, expression, and signaling specificity.Chen M., She H., Davis E.M., Spicer C.M., Kim L., Ren R., LeBeau M.M., Li W.J. Biol. Chem. 273:25171-25178(1998)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close