Comparison

Recombinant Staphylococcus aureus Acyl carrier protein(acpP),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP015636SKX-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
MENFDKVKDIIVDRLGVDADKVTEDASFKDDLGAD SLDIAELVMELEDEFGTEIPDEEAEKINTVGDAVK FINSLEK
Research Topic
Others
Uniprot ID
P0A001
Gene Names
acpP
Tag Info
N-terminal GST-tagged
Expression Region
1-77aa
MW of Fusion Proten
35, 5
Sequence Info
Partial
Relevance
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Is able to confer high methicillin resistance to S.aureus when overproduced .
Reference
Whole genome sequencing of meticillin-resistant Staphylococcus aureus.Kuroda M., Ohta T., Uchiyama I., Baba T., Yuzawa H., Kobayashi I., Cui L., Oguchi A., Aoki K., Nagai Y., Lian J.-Q., Ito T., Kanamori M., Matsumaru H., Maruyama A., Murakami H., Hosoyama A., Mizutani-Ui Y. , Takahashi N.K., Sawano T., Inoue R., Kaito C., Sekimizu K., Hirakawa H., Kuhara S., Goto S., Yabuzaki J., Kanehisa M., Yamashita A., Oshima K., Furuya K., Yoshino C., Shiba T., Hattori M., Ogasawara N., Hayashi H., Hiramatsu K.Lancet 357:1225-1240(2001)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Staphylococcus aureus (strain Mu50 / ATCC 700699)
Amount: 100ug
Available: In stock
Listprice: €610.49
Price: €610.49
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close