« Back
Home /
Recombinant Staphylococcus aureus Acyl carrier protein(acpP)

Recombinant Staphylococcus aureus Acyl carrier protein(acpP)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	100ug
Host	E.coli
Item no.	CSB-EP015636SKX-100
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	others
Target / Protein	acpP
Biologically Active	Not Test
Expression System	E.coli
Species of origin	Staphylococcus aureus (strain Mu50 / ATCC 700699)
Uniprot ID	P0A001
AA Sequence	MENFDKVKDIIVDRLGVDADKVTEDASFKDDLGAD SLDIAELVMELEDEFGTEIPDEEAEKINTVGDAVK FINSLEK
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	1-77aa
Protein Length	Full Length
MW	24.5 kDa
Distributor Discount	50% off the list price
Alternative Name(s)	hmrB
Relevance	Carrier of the growing fatty acid chain in fatty acid biosynthesis. Is able to confer high methicillin resistance to S.aureus when overproduced
Reference	Whole genome sequencing of meticillin-resistant Staphylococcus aureus. Kuroda M., Ohta T., Uchiyama I., Baba T., Yuzawa H., Kobayashi I., Cui L., Oguchi A., Aoki K., Nagai Y., Lian J.-Q., Ito T., Kanamori M., Matsumaru H., Maruyama A., Murakami H., Hosoyama A., Mizutani-Ui Y.Hiramatsu K. Lancet 357:1225-1240(2001)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Carrier of the growing fatty acid chain in fatty acid biosynthesis. Is able to confer high methicillin resistance to S.aureus when overproduced (By similarity).
Subcellular Location	Cytoplasm
Protein Families	Acyl carrier protein (ACP) family
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time