Comparison

Recombinant Human NK-tumor recognition protein(NKTR),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP015838HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Natural-killer cells cyclophilin-related protein 1 domains:Putative peptidyl-prolyl cis-trans isomerase (EC:5.2.1.8) ; PPIase ; Rotamase
AA Sequence
HFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCS GEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFS EGNGKGGESIYGGYFKDENFILKHDRAFLLSMANR GKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEV IEQIENLKTDAASRPYADVRVIDCGV
Research Topic
Cancer
Uniprot ID
P30414
Gene Names
NKTR
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
10-175aa
MW of Fusion Proten
34, 4
Sequence Info
Partial
Relevance
Component of a putative tumor-recognition complex. Involved in the function of NK cells.
Reference
An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close