« Back
Home /
Recombinant Human NK-tumor recognition protein(NKTR),partial

Recombinant Human NK-tumor recognition protein(NKTR),partial

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	100ug
Host	E.coli
Item no.	CSB-EP015838HU-100
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Cancer
Uniprot ID	P30414
Gene Names	NKTR
Organism	Homo sapiens (Human)
AA Sequence	HFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCS GEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFS EGNGKGGESIYGGYFKDENFILKHDRAFLLSMANR GKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEV IEQIENLKTDAASRPYADVRVIDCGV
Expression Region	10-175aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	34.4 kDa
Alternative Name(s)	Natural-killer cells cyclophilin-related protein 1 domains:Putative peptidyl-prolyl cis-trans isomerase (EC:5.2.1.8) ; PPIase ; Rotamase
Relevance	Component of a putative tumor-recognition complex. Involved in the function of NK cells.
Reference	An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Component of a putative tumor-recognition complex. Involved in the function of NK cells.
Subcellular Location	Membrane, Peripheral membrane protein
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP015838HU-100-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time