Comparison

Recombinant Human NK-tumor recognition protein(NKTR),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP015838HU-100
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Cancer
Uniprot ID
P30414
Gene Names
NKTR
Organism
Homo sapiens (Human)
AA Sequence
HFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCS GEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFS EGNGKGGESIYGGYFKDENFILKHDRAFLLSMANR GKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEV IEQIENLKTDAASRPYADVRVIDCGV
Expression Region
10-175aa
Sequence Info
Partial
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
34.4 kDa
Alternative Name
Natural-killer cells cyclophilin-related protein 1 domains:Putative peptidyl-prolyl cis-trans isomerase (EC:5.2.1.8) . PPIase . Rotamase
Relevance
Component of a putative tumor-recognition complex. Involved in the function of NK cells.
Reference
An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Component of a putative tumor-recognition complex. Involved in the function of NK cells.
Subcellular Location
Membrane, Peripheral membrane protein
Amount: 100ug
Available: In stock
Listprice: €405.35
Price: €405.35
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close