Comparison

Recombinant Mouse Homeobox protein Nkx-3.2(Nkx3-2)

Item no. CSB-EP015849MOb1-200
Manufacturer Cusabio
Amount 200 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag Myc, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPA PGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSL LASPARTRTAVGQSAESPGGWDSDSALSEENEGRR RCADVPGASGTGRARVTLGLDQPGCELHAAKDLEE EAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVP GLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSR AAFSHAQVFELERRFNHQRYLSGPERADLAASLKL TET
Protein Family NK-3 homeobox family
Citations "Bapx1: an evolutionary conserved homologue of the Drosophila bagpipe homeobox gene is expressed in splanchnic mesoderm and the embryonic skeleton."
Tribioli C., Frasch M., Lufkin T.
Mech. Dev. 65:145-162(1997)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Bagpipe homeobox protein homolog 1; Homeobox protein NK-3 homolog B
Available
Manufacturer - Targets
Nkx3-2
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
40.2 kDa
General Research Areas
Epigenetics and Nuclear Signaling
Relevance
Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a role in distal stomach development; required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear; required for tympanic ring and gonium development and in the regulation of the width of the malleus.
Expression Region
1-333aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a role in distal stomach development; required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear; required for tympanic ring and gonium development and in the regulation of the width of the malleus.
Subcellular Location
Nucleus
Tissue Specificity
Expressed widely in mesoderm at the gastroduodenal junction (at protein level). Expressed in visceral mesoderm and embryonic skeleton. Expression is restricted to immature proliferative chondrocytes during endochondral ossification.
Biologically active
Not Test
Protein length
Full Length

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close