Comparison

Recombinant Human Atrial natriuretic peptide receptor 1(NPR1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP016023HU-100
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Cardiovascular
Uniprot ID
P16066
Gene Names
NPR1
Organism
Homo sapiens (Human)
AA Sequence
GNLTVAVVLPLANTSYPWSWARVGPAVELALAQVK ARPDLLPGWTVRTVLGSSENALGVCSDTAAPLAAV DLKWEHNPAVFLGPGCVYAAAPVGRFTAHWRVPLL TAGAPALGFGVKDEYALTTRAGPSYAKLGDFVAAL HRRLGWERQALMLYAYRPGDEEHCFFLVEGLFMRV RDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGRVI YICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFG QSLQGGQGPAPRRPWERGDGQDVSARQAFQAAKII TYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDGLVN TIPASFHDGLLLYIQAVTETLAHGGTVTDGENITQ RMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPEN GAFRVVLNYNGTSQELVAVSGRKLNWPLGYPPPDI PKCGFDNEDPACNQDHLSTLE
Expression Region
33-473aa
Sequence Info
Extracellular Domain
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
64.9 kDa
Alternative Name
Atrial natriuretic peptide receptor type A . ANP-A . ANPR-A . NPR-AGuanylate cyclase A . GC-A
Relevance
Receptor for the atrial natriuretic peptide NPPA/ANP and the brain natriuretic peptide NPPB/BNP which are potent vasoactive hormones playing a key role in cardiovascular homeostasis. Has guanylate cyclase activity upon binding of the ligand.
Reference
The DNA sequence and biological annotation of human chromosome 1.Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.Nature 441:315-321(2006)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Receptor for the atrial natriuretic peptide NPPA/ANP and the brain natriuretic peptide NPPB/BNP which are potent vasoactive hormones playing a key role in cardiovascular homeostasis. Has guanylate cyclase activity upon binding of the ligand.
Subcellular Location
Membrane, Single-pass type I membrane protein
Protein Families
Adenylyl cyclase class-4/guanylyl cyclase family
Paythway
cAMPsignalingpathway
Amount: 100ug
Available: In stock
Listprice: €405.35
Price: €405.35
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close