« Back
Home /
Recombinant Mouse Nuclear receptor subfamily 2 group F member 6(Nr2f6)

Recombinant Mouse Nuclear receptor subfamily 2 group F member 6(Nr2f6)

Item no.	CSB-EP016058MO-200
Manufacturer	Cusabio
Amount	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Conjugate/Tag	Myc, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MAMVTGGWGDPGGDTNGVDKAGGSYPRATEDDSAS PPGATSDAEPGDEERPGLQVDCVVCGDKSSGKHYG VFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHH RNQCQYCRLKKCFRVGMRKEAVQRGRIPHALPGPA ACSPPGATGVEPFTGPPVSELIAQLLRAEPYPAAG RFGGGGAVLGIDNVCELAARLLFSTVEWARHAPFF PELPAADQVALLRLSWSELFVLNAAQAALPLHTAP LLA
Protein Family	Nuclear hormone receptor family, NR2 subfamily
Citations	"Abnormal development of the locus coeruleus in Ear2(Nr2f6)-deficient mice impairs the functionality of the forebrain clock and affects nociception." Warnecke M., Oster H., Revelli J.P., Alvarez-Bolado G., Eichele G. Genes Dev. 19:614-625(2005)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	COUP transcription factor 3 (COUP-TF3) (V-erbA-related protein 2) (EAR-2) (Ear-2) (Ear2) (Erbal2)
Available
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	49.4 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Epigenetics and Nuclear Signaling
Relevance	Transcription factor predominantly involved in transcriptional repression. Binds to promoter/enhancer response elements that contain the imperfect 5'-AGGTCA-3' direct or inverted repeats with various spacings which are also recognized by other nuclear hormone receptors. Involved in modulation of hormonal responses. Represses transcriptional activity of the lutropin-choriogonadotropic hormone receptor/LHCGR gene, the renin/REN gene and the oxytocin-neurophysin/OXT gene. Represses the triiodothyronine-dependent and -independent transcriptional activity of the thyroid hormone receptor gene in a cell type-specific manner. The corepressing function towards thyroid hormone receptor beta/THRB involves at least in part the inhibition of THRB binding to triiodothyronine response elements by NR2F6. Inhibits NFATC transcription factor DNA binding and subsequently its transcriptional activity. Acts as transcriptional repressor of IL-17 expression in Th-17 differentiated CD4+ T cells and may be involved in induction and/or maintenance of peripheral immunological tolerance and autoimmunity. Involved in development of forebrain circadian clock; is required early in the development of the locus coeruleus.
Expression Region	1-390aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Transcription factor predominantly involved in transcriptional repression. Binds to promoter/enhancer response elements that contain the imperfect 5'-AGGTCA-3' direct or inverted repeats with various spacings which are also recognized by other nuclear hormone receptors. Involved in modulation of hormonal responses. Represses transcriptional activity of the lutropin-choriogonadotropic hormone receptor/LHCGR gene, the renin/REN gene and the oxytocin-neurophysin/OXT gene. Represses the triiodothyronine-dependent and -independent transcriptional activity of the thyroid hormone receptor gene in a cell type-specific manner. The corepressing function towards thyroid hormone receptor beta/THRB involves at least in part the inhibition of THRB binding to triiodothyronine response elements (TREs) by NR2F6. Inhibits NFATC transcription factor DNA binding and subsequently its transcriptional activity. Acts as transcriptional repressor of IL-17 expression in Th-17 differentiated CD4(+) T cells and may be involved in induction and/or maintenance of peripheral immunological tolerance and autoimmunity. Involved in development of forebrain circadian clock; is required early in the development of the locus coeruleus (LC).
Subcellular Location	Nucleus
Gene Names	Nr2f6
Sequence Info	Full Length
Organism	Mus musculus (Mouse)
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP016058MO-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug

available

Delivery expected until 11/20/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer