Comparison

Recombinant Mouse Oncomodulin(Ocm)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP016264MO-1
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Neuroscience
Uniprot ID
P51879
Gene Names
Ocm
Organism
Mus musculus (Mouse)
AA Sequence
SITDILSADDIAAALQECQDPDTFEPQKFFQTSGL SKMSASQLKDIFQFIDNDQSGYLDEDELKYFLQRF QSDARELTESETKSLMDAADNDGDGKIGADEFQEM VHS
Expression Region
2-109aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
28.1 kDa
Alternative Name
Parvalbumin beta
Relevance
Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions.
Reference
"The intracisternal A particle derived solo LTR promoter of the rat oncomodulin gene is not present in the mouse gene."Banville D., Rotaru M., Boie Y.Genetica 86:85-97(1992)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions.
Protein Families
Parvalbumin family
Tissue Specificity
Found in tumor tissues and not detected in normal tissues.
Amount: 1mg
Available: In stock
Listprice: €2,191.83
Price: €2,191.83
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close