Comparison

Recombinant Human Ornithine decarboxylase(ODC1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Format Liquid
Amount 100ug
Host E.coli
Item no. CSB-EP016269HU-100
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
P11926
Gene Names
ODC1
Organism
Homo sapiens (Human)
AA Sequence
MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSD DKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKC NDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPP ERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELM KVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLR TSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQ AISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVK LKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYV ASAFTLAVNIIAKKIVLKEQTGSDDEDESSEQTFM YYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKY YSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFEN MGAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQF QNPDFPPEVEEQDASTLPVSCAWESGMKRHRAACA SASINV
Expression Region
1-461aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
MW
71.1 kDa
Relevance
Key enzyme of polyamine biosynthesis that converts ornithine into putrescine, which is the precursor for the polyamines, spermidine and spermine.
Reference
"Complete amino acid sequence of human ornithine decarboxylase deduced from complementary DNA."Hickok N.J., Seppaenen P.J., Gunsalus G.L., Jaenne O.A.DNA 6:179-187(1987)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Catalyzes the first and rate-limiting step of polyamine biosynthesis that converts ornithine into putrescine, which is the precursor for the polyamines, spermidine and spermine. Polyamines are essential for cell proliferation and are implicated in cellular processes, ranging from DNA replication to apoptosis.
Protein Families
Orn/Lys/Arg decarboxylase class-II family
Amount: 100ug
Available: In stock
Listprice: €690.56
Price: €690.56
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close