Comparison

Recombinant Human Poly(A)-specific ribonuclease PARN(PARN)

Manufacturer Cusabio
Category
Type Proteins Recombinant
Specific against other
Format Liquid or Lyophilized powder
Amount 200ug
Host E.coli
Item no. CSB-EP017456HU-200
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Transcription
Uniprot ID
O95453
Gene Names
PARN
Organism
Homo sapiens (Human)
AA Sequence
MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGIS DGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFG LCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVK FVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEER QLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPE DQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQR KLIYQTLSWKYPKGIHVETLETEKKERYIVISKVD EEERKRREQQKHAKEQEELNDAVGFSRVIHAIANS GKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMT TCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRL KETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYI TGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFN KLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKE WKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQ VKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRK WTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSFTA PSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTD SCAEPLSEGRKKAKKLKRMKKELSPAGSISKNSPA TLFEVPDTW
Expression Region
1-639aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal 6xHis-tagged
MW
77.5 kDa
Alternative Name(s)
Deadenylating nucleaseDeadenylation nucleasePolyadenylate-specific ribonuclease
Relevance
3'-exoribonuclease that has a preference for poly(A) tails of mRNAs, thereby efficiently degrading poly(A) tails. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs and is also used to silence certain maternal mRNAs translationally during oocyte maturation and early bryonic development. Interacts with both the 3'-end poly(A) tail and the 5'-end cap structure during degradation, the interaction with the cap structure being required for an efficient degradation of poly(A) tails. Involved in nonsense-mediated mRNA decay, a critical process of selective degradation of mRNAs that contain prature stop codons. Also involved in degradation of inherently unstable mRNAs that contain AU-rich elents (AREs) in their 3'-UTR, possibly via its interaction with KHSRP. Probably mediates the roval of poly(A) tails of AREs mRNAs, which constitutes the first step of destabilization.
Reference
The sequence and analysis of duplication-rich human chromosome 16.Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.Nature 432:988-994(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
3'-exoribonuclease that has a preference for poly(A) tails of mRNAs, thereby efficiently degrading poly(A) tails. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs and is also used to silence certain maternal mRNAs translationally during oocyte maturation and early embryonic development. Interacts with both the 3'-end poly(A) tail and the 5'-end cap structure during degradation, the interaction with the cap structure being required for an efficient degradation of poly(A) tails. Involved in nonsense-mediated mRNA decay, a critical process of selective degradation of mRNAs that contain premature stop codons. Also involved in degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3'-UTR, possibly via its interaction with KHSRP. Probably mediates the removal of poly(A) tails of AREs mRNAs, which constitutes the first step of destabilization.
Involvement in disease
Dyskeratosis congenita, autosomal recessive, 6 (DKCB6); Pulmonary fibrosis, and/or bone marrow failure, telomere-related, 4 (PFBMFT4)
Subcellular Location
Nucleus, Cytoplasm, Nucleus, nucleolus
Protein Families
CAF1 family
Tissue Specificity
Ubiquitous.
Tag Information
N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close