Comparison

Recombinant Saccharomyces cerevisiae Proliferating cell nuclear antigen(POL30)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP017621SVG-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
PCNA
AA Sequence
MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGI IAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGM DLTSLSKILRCGNNTDTLTLIADNTPDSIILLFED TKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLP SSEFSKIVRDLSQLSDSINIMITKETIKFVADGDI GSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAK YLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGF LQFFLAPKFNDEE
Research Topic
Others
Uniprot ID
P15873
Gene Names
POL30
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-258aa
MW of Fusion Proten
44, 9
Sequence Info
Full Length
Relevance
This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Involved in DNA repair.
Reference
"Molecular cloning, structure and expression of the yeast proliferating cell nuclear antigen gene."Bauer G.A., Burgess P.M.J.Nucleic Acids Res. 18:261-265(1990)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Amount: 100ug
Available: In stock
Listprice: €610.49
Price: €610.49
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close