Comparison

Recombinant Human Procollagen C-endopeptidase enhancer 2(PCOLCE2)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP017632HU-100
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Cell Biology
Uniprot ID
Q9UKZ9
Gene Names
PCOLCE2
Organism
Homo sapiens (Human)
AA Sequence
QSPERPVFTCGGILTGESGFIGSEGFPGVYPPNSK CTWKITVPEGKVVVLNFRFIDLESDNLCRYDFVDV YNGHANGQRIGRFCGTFRPGALVSSGNKMMVQMIS DANTAGNGFMAMFSAAEPNERGDQYCGGLLDRPSG SFKTPNWPDRDYPAGVTCVWHIVAPKNQLIELKFE KFDVERDNYCRYDYVAVFNGGEVNDARRIGKYCGD SPPAPIVSERNELLIQFLSDLSLTADGFIGHYIFR PKKLPTTTEQPVTTTFPVTTGLKPTVALCQQKCRR TGTLEGNYCSSDFVLAGTVITTITRDGSLHATVSI INIYKEGNLAIQQAGKNMSARLTVVCKQCPLLRRG LNYIIMGQVGEDGRGKIMPNSFIMMFKTKNQKLLD ALKNKQC
Expression Region
24-415aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
59.3 kDa
Alternative Name
Procollagen COOH-terminal proteinase enhancer 2
Short name:
PCPE-2
Short name:
Procollagen C-proteinase enhancer 2
Relevance
Binds to the C-terminal propeptide of types I and II procollagens and may enhance the cleavage of that propeptide by BMP1.
Reference
"PCOLCE2 encodes a functional procollagen C-proteinase enhancer (PCPE2) that is a collagen-binding protein differing in distribution of expression and post-translational modification from the previously described PCPE1."Steiglitz B.M., Keene D.R., Greenspan D.S.J. Biol. Chem. 277:49820-49830(2002)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Binds to the C-terminal propeptide of types I and II procollagens and may enhance the cleavage of that propeptide by BMP1.
Subcellular Location
Secreted
Tissue Specificity
Highly expressed in the heart, trabecular meshwork, pituitary gland, bladder, mammary gland, trachea and placenta and weakly expressed in the brain. Expressed in cartilage.
Amount: 100ug
Available: In stock
Listprice: €405.35
Price: €405.35
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close