Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
200ug |
Host |
E.coli |
Item no. |
CSB-EP017642RA-200 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Signal Transduction |
Uniprot ID |
P28841 |
Gene Names |
Pcsk2 |
Organism |
Rattus norvegicus (Rat) |
AA Sequence |
GYRDINEIDINMNDPLFTKQWYLFNTGQADGTPGL DLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLAY NYNSDASYDFSSNDPYPYPRYTDDWFNSHGTRCAG EVSAAASNNICGVGVAYNSKVAGIRMLDQPFMTDI IEASSISHMPQLIDIYSASWGPTDNGKTVDGPREL TLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNC DGYASSMWTISINSAINDGRTALYDESCSSTLAST FSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPE AAGVFALALEANVDLTWRDMQHLTVLTSKRNQLHD EVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDW KTVPERFHCVGGSVQNPEKIPPTGKLVLTLQTNAC EGKENFVRYLEHVQAVITVNATRRGDLNINMTSPM GTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDA RGTWTLELGFVGSAPQKGLLKEWTLMLHGTQSAPY IDQVVRDYQSKLAMSKKQELEEELDEAVERSLQSI LRKN |
Expression Region |
109-637aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
62.3 kDa |
Alternative Name(s) |
NEC 2 Alternative name(s): KEX2-like endoprotease 2 Prohormone convertase 2 Proprotein convertase 2 Short name: PC2 |
Relevance |
Involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Responsible for the release of glucagon from proglucagon in pancreatic A cells (By similarity). |
Reference |
"Isolation of two complementary deoxyribonucleic acid clones from a rat insulinoma cell line based on similarities to Kex2 and furin sequences and the specific localization of each transcript to endocrine and neuroendocrine tissues in rats."Hakes D.J., Birch N.P., Mezey A., Dixon J.E.Endocrinology 129:3053-3063(1991). |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Responsible for the release of glucagon from proglucagon in pancreatic A cells (By similarity). |
Subcellular Location |
Cytoplasmic vesicle, secretory vesicle, Secreted |
Protein Families |
Peptidase S8 family, Furin subfamily |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.