Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
100ug |
Host |
E.coli |
Item no. |
CSB-EP017707ENV-100 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research areas |
Others |
Target / Protein |
def |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Escherichia coli (strain K12) |
Uniprot ID |
P0A6K3 |
AA Sequence |
SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMF ETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERL VLINPELLEKSGETGIEEGCLSIPEQRALVPRAEK VKIRALDRDGKPFELEADGLLAICIQHEMDHLVGK LFMDYLSPLKQQRIRQKVEKLDRLKARA |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Expression Region |
2-169aa |
Protein length |
Full Length of Mature Protein |
MW |
35.2 kDa |
Alternative Name(s) |
Polypeptide deformylase |
Relevance |
Roves the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions. |
References |
Structural basis for the design of antibiotics targeting peptide deformylase.Hao B., Gong W., Rajagopalan P.T.R., Zhou Y., Pei D., Chan M.K.Biochemistry 38:4712-4719(1999) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Removes the formyl group from the N-terminal Met of newly synthesized proteins |
Protein Families |
Polypeptide deformylase family |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.