Comparison

Recombinant Escherichia coli Peptide deformylase(def)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP017707EOD-50
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
P0A6K5
Gene Names
def
Organism
Escherichia coli O157:H7
AA Sequence
SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMF ETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERL VLINPELLEKSGETGIEEGCLSIPEQRALVPRAEK VKIRALDRDGKPFELEADGLLAICIQHEMDHLVGK LFMDYLSPLKQQRIRQKVEKLDRLKARA
Expression Region
2-169aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
35.2 kDa
Alternative Name
Polypeptide deformylase
Relevance
Roves the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.
Reference
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions (By similarity).
Protein Families
Polypeptide deformylase family
Amount: 50ug
Available: In stock
Listprice: €426.10
Price: €426.10
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close