Comparison

Recombinant Staphylococcus aureus Peptide deformylase(def)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP017707FKZ-100
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
P68826
Gene Names
def
Organism
Staphylococcus aureus
AA Sequence
MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLI AMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISK RMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYL PTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDI QLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQ PHTDAVEV
Expression Region
1-183aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
36.6 kDa
Alternative Name
Polypeptide deformylase
Relevance
Roves the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions .
Reference
Staphylococcus aureus deformylase 1 encoding DNA.Lonetto M.A., Sylvester D.R., Warren R.L. Identification of Staphylococcus aureus proteins recognized by the antibody-mediated immune response to a biofilm infection.Brady R.A., Leid J.G., Camper A.K., Costerton J.W., Shirtliff M.E.Infect. Immun. 74:3415-3426(2006)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions (By similarity).
Protein Families
Polypeptide deformylase family
Amount: 100ug
Available: In stock
Listprice: €690.56
Price: €690.56
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close