Comparison

Recombinant Human Pyridoxal kinase(PDXK)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP017748HU-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Pyridoxine kinase
AA Sequence
MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEI DAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLR LNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQN PRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKV VPLADIITPNQFEAELLSGRKIHSQEEALRVMDML HSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNP AGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWT HKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGE GVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
Research Topic
Signal Transduction
Uniprot ID
O00764
Gene Names
PDXK
Tag Info
N-terminal GST-tagged
Expression Region
1-312aa
MW of Fusion Proten
62, 1
Sequence Info
Full Length
Relevance
Required for synthesis of pyridoxal-5-phosphate from vitamin B6.
Reference
"Human pyridoxal kinase. cDNA cloning, expression, and modulation by ligands of the benzodiazepine receptor."
Hanna M.C., Turner A.J., Kirkness E.F.
J. Biol. Chem. 272:10756-10760(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 50ug
Available: In stock
Listprice: €199.38
Price: €199.38
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close