Comparison

Recombinant Human Peroxisomal biogenesis factor 19(PEX19)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 500ug
Host E.coli
Item no. CSB-EP017802HU-500
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Areas
Tags & Cell Markers
Uniprot NO.
P40855
Gene Names
PEX19
Source
E.coli
Expression Region
2-296aa
Sequence
AAAEEGCSVGAEADRELEELLESALDDFDKAKPSP APPSTTTAPDASGPQKRSPGDTAKDALFASQEKFF QELFDSELASQATAEFEKAMKELAEEEPHLVEQFQ KLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNAT DLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQ SIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLP PEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKA RFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLD ALNLSGPPGASGEQC
Protein Description
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Mol. Weight
59.3 kDa
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized ABCD1 at 5 ?g/ml can bind human PEX19, the EC50 of human PEX19 protein is 22.96-33.00 ?g/ml.
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Not test.
Storage Buffer
Tris-based buffer, 50% glycerol
Alternative Name
33 kDa housekeeping protein
Peroxin-19
Peroxisomal farnesylated protein
Relevance
Necessary for early peroxisomal biogenesis. Acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs). Binds and stabilizes newly synthesized PMPs in the cytoplasm by interacting with their hydrophobic membrane-spanning domains, and targets them to the peroxisome membrane by binding to the integral membrane protein PEX3. Excludes CDKN2A from the nucleus and prevents its interaction with MDM2, which results in active degradation of TP53.
Amount: 500ug
Available: In stock
Listprice: €1,013.82
Price: €1,013.82
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close