Comparison

Recombinant Human Peroxisomal biogenesis factor 19(PEX19)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 500ug
Host E.coli
Item no. CSB-EP017802HU-500
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
33 kDa housekeeping protein
Peroxin-19
Peroxisomal farnesylated protein
AA Sequence
AAAEEGCSVGAEADRELEELLESALDDFDKAKPSP APPSTTTAPDASGPQKRSPGDTAKDALFASQEKFF QELFDSELASQATAEFEKAMKELAEEEPHLVEQFQ KLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNAT DLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQ SIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLP PEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKA RFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLD ALNLSGPPGASGEQC
Research Topic
Tags & Cell Markers
Uniprot ID
P40855
Gene Names
PEX19
Tag Info
N-terminal GST-tagged
Expression Region
1-299aa
MW of Fusion Proten
59, 3
Sequence Info
Full Length
Relevance
Necessary for early peroxisomal biogenesis. Acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs). Binds and stabilizes newly synthesized PMPs in the cytoplasm by interacting with their hydrophobic membrane-spanning domains, and targets them to the peroxisome membrane by binding to the integral membrane protein PEX3. Excludes CDKN2A from the nucleus and prevents its interaction with MDM2, which results in active degradation of TP53.
Reference
"Genomic organization and molecular characterization of a gene encoding HsPXF, a human peroxisomal farnesylated protein."
Kammerer S., Arnold N., Gutensohn W., Mewes H.-W., Kunau W.-H., Hoefler G., Roscher A.A., Braun A.
Genomics 45:200-210(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 500ug
Available: In stock
Listprice: €598.72
Price: €598.72
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close