Comparison

Recombinant Human Phosphoglucomutase-1(PGM1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP017866HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Glucose phosphomutase 1
AA Sequence
MVKIVTVKTQAYQDQKPGTSGLRKRVKVFQSSANY AENFIQSIISTVEPAQRQEATLVVGGDGRFYMKEA IQLIARIAAANGIGRLVIGQNGILSTPAVSCIIRK IKAIGGIILTASHNPGGPNGDFGIKFNISNGGPAP EAITDKIFQISKTIEEYAVCPDLKVDLGVLGKQQF DLENKFKPFTVEIVDSVEAYATMLRSIFDFSALKE LLSGPNRLKIRIDAMHGVVGPYVKKILCEELGAPA NSAVNCVPLEDFGGHHPDPNLTYAADLVETMKSGE HDFGAAFDGDGDRNMILGKHGFFVNPSDSVAVIAA NIFSIPYFQQTGVRGFARSMPTSGALDRVASATKI ALYETPTGWKFFGNLMDASKLSLCGEESFGTGSDH IREKDGLWAVLAWLSILATRKQSVEDILKDHWQKY GRNFFTRYDYEEVEAEGANKMMKDLEALMFDRSFV GKQFSANDKVYTVEKADNFEYSDPVDGSISRNQGL RLIFTDGSRIVFRLSGTGSAGATIRLYIDSYEKDV AKINQDPQVMLAPLISIALKVSQLQERTGRTAPTV IT
Research Topic
Metabolism
Uniprot ID
P36871
Gene Names
PGM1
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-562aa
MW of Fusion Proten
77, 4
Sequence Info
Full Length
Relevance
This enzyme participates in both the breakdown and synthesis of glucose.
Reference
Phosphoglucomutase 1 complete human and rabbit mRNA sequences and direct mapping of this highly polymorphic marker on human chromosome 1.Whitehouse D.B., Putt W., Lovegrove J.U., Morrison K.E., Hollyoake M., Fox M.F., Hopkinson D.A., Edwards Y.H.Proc. Natl. Acad. Sci. U.S.A. 89:411-415(1992)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close