Comparison

Recombinant Human Phosphoglucomutase-1(PGM1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 500ug
Host E.coli
Item no. CSB-EP017866HU-500
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Metabolism
Uniprot ID
P36871
Gene Names
PGM1
Organism
Homo sapiens (Human)
AA Sequence
MVKIVTVKTQAYQDQKPGTSGLRKRVKVFQSSANY AENFIQSIISTVEPAQRQEATLVVGGDGRFYMKEA IQLIARIAAANGIGRLVIGQNGILSTPAVSCIIRK IKAIGGIILTASHNPGGPNGDFGIKFNISNGGPAP EAITDKIFQISKTIEEYAVCPDLKVDLGVLGKQQF DLENKFKPFTVEIVDSVEAYATMLRSIFDFSALKE LLSGPNRLKIRIDAMHGVVGPYVKKILCEELGAPA NSAVNCVPLEDFGGHHPDPNLTYAADLVETMKSGE HDFGAAFDGDGDRNMILGKHGFFVNPSDSVAVIAA NIFSIPYFQQTGVRGFARSMPTSGALDRVASATKI ALYETPTGWKFFGNLMDASKLSLCGEESFGTGSDH IREKDGLWAVLAWLSILATRKQSVEDILKDHWQKY GRNFFTRYDYEEVEAEGANKMMKDLEALMFDRSFV GKQFSANDKVYTVEKADNFEYSDPVDGSISRNQGL RLIFTDGSRIVFRLSGTGSAGATIRLYIDSYEKDV AKINQDPQVMLAPLISIALKVSQLQERTGRTAPTV IT
Expression Region
1-562aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
77.4 kDa
Alternative Name
Glucose phosphomutase 1
Relevance
This enzyme participates in both the breakdown and synthesis of glucose.
Reference
Phosphoglucomutase 1 complete human and rabbit mRNA sequences and direct mapping of this highly polymorphic marker on human chromosome 1.Whitehouse D.B., Putt W., Lovegrove J.U., Morrison K.E., Hollyoake M., Fox M.F., Hopkinson D.A., Edwards Y.H.Proc. Natl. Acad. Sci. U.S.A. 89:411-415(1992)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
This enzyme participates in both the breakdown and synthesis of glucose.
Involvement in disease
Congenital disorder of glycosylation 1T (CDG1T)
Subcellular Location
Isoform 1: Cytoplasm
Protein Families
Phosphohexose mutase family
Amount: 500ug
Available: In stock
Listprice: €1,013.82
Price: €1,013.82
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close