Comparison

Recombinant Human PHD finger protein 11(PHF11)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP017900HU-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
BRCA1 C-terminus-associated protein
Renal carcinoma antigen NY-REN-34
AA Sequence
MEKRTCALCPKDVEYNVLYFAQSENIAAHENCLLY SSGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLK CKFCHKRGATVGCDLKNCNKNYHFFCAKKDDAVPQ SDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRG RKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDA TVKVPFLKKCKEAGLLNYLLEEILDKVHSIPEKLM DETTSESDYEEIGSALFDCRLFEDTFVNFQAAIEK KIHASQQRWQQLKEEIELLQDLKQTLCSFQENRDL MSSSTSISSLSY
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
Q9UIL8
Gene Names
PHF11
Tag Info
N-terminal GST-tagged
Expression Region
1-292aa
MW of Fusion Proten
60, 5
Sequence Info
Full Length of Isoform 2
Relevance
Positive regulator of Th1-type cytokine gene expression.
Reference
"Antigens recognized by autologous antibody in patients with renal-cell carcinoma."
Scanlan M.J., Gordan J.D., Williamson B., Stockert E., Bander N.H., Jongeneel C.V., Gure A.O., Jaeger D., Jaeger E., Knuth A., Chen Y.-T., Old L.J.
Int. J. Cancer 83:456-464(1999)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 50ug
Available: In stock
Listprice: €199.38
Price: €199.38
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close