Comparison

Recombinant Human Phytanoyl-CoA dioxygenase, peroxisomal(PHYH)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-EP017946HU-200
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
O14832
Gene Names
PHYH
Organism
Homo sapiens (Human)
AA Sequence
SGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENG FLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTV MRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCT LPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTS RHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGC LVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYE ENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFR KAISCHFASADCHYIDVKGTSQENIEKEVVGIAHK FFGAENSVNLKDIWMFRARLVKGERTNL
Expression Region
1-338aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
62.4 kDa
Alternative Name
Phytanic acid oxidase
Phytanoyl-CoA alpha-hydroxylase
Relevance
Converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA.
Reference
"Identification of PAHX, a Refsum disease gene."
Mihalik S.J., Morrell J.C., Kim D., Sachsteder K.A., Watkins P.A., Gould S.J.
Nat. Genet. 17:185-189(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA.
Involvement in disease
Refsum disease (RD)
Subcellular Location
Peroxisome
Protein Families
PhyH family
Tissue Specificity
Expressed in liver, kidney, and T-cells, but not in spleen, brain, heart, lung and skeletal muscle.
Amount: 200ug
Available: In stock
Listprice: €628.34
Price: €628.34
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close