Comparison

Recombinant Human Pyruvate kinase isozymes R/L(PKLR)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP018071HU-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Metabolism
Uniprot ID
P30613
Gene Names
PKLR
Organism
Homo sapiens (Human)
AA Sequence
MSIQENISSLQLRSWVSKSQRDLAKSILIGAPGGP AGYLRRASVAQLTQELGTAFFQQQQLPAAMADTFL EHLCLLDIDSEPVAARSTSIIATIGPASRSVERLK EMIKAGMNIARLNFSHGSHEYHAESIANVREAVES FAGSPLSYRPVAIALDTKGPEIRTGILQGGPESEV ELVKGSQVLVTVDPAFRTRGNANTVWVDYPNIVRV VPVGGRIYIDDGLISLVVQKIGPEGLVTQVENGGV LGSRKGVNLPGAQVDLPGLSEQDVRDLRFGVEHGV DIVFASFVRKASDVAAVRAALGPEGHGIKIISKIE NHEGVKRFDEILEVSDGIMVARGDLGIEIPAEKVF LAQKMMIGRCNLAGKPVVCATQMLESMITKPRPTR AETSDVANAVLDGADCIMLSGETAKGNFPVEAVKM QHAIAREAEAAVYHRQLFEELRRAAPLSRDPTEVT AIGAVEAAFKCCAAAIIVLTTTGRSAQLLSRYRPR AAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIW ADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRP GSGYTNIMRVLSIS
Expression Region
1-574aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal 6xHis-tagged
MW
65.8 kDa
Alternative Name
Pyruvate kinase 1. Pyruvate kinase isozymes L/RR-type/L-type pyruvate kinaseRed cell/liver pyruvate kinase
Relevance
Plays a key role in glycolysis.
Reference
Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Plays a key role in glycolysis.
Involvement in disease
Pyruvate kinase hyperactivity (PKHYP); Pyruvate kinase deficiency of red cells (PKRD)
Protein Families
Pyruvate kinase family
Paythway
Insulinsignalingpathway
Amount: 10ug
Available: In stock
Listprice: €175.45
Price: €175.45
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close