Comparison

Recombinant Rat Pyruvate kinase isozymes R/L(Pklr)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP018071RA-50
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
P12928
Gene Names
Pklr
Organism
Rattus norvegicus (Rat)
AA Sequence
MSVQENTLPQQLWPWIFRSQKDLAKSALSGAPGGP AGYLRRASVAQLTQELGTAFFQQQQLPAAMADTFL EHLCLLDIDSQPVAARSTSIIATIGPASRSVDRLK EMIKAGMNIARLNFSHGSHEYHAESIANIREATES FATSPLSYRPVAIALDTKGPEIRTGVLQGGPESEV EIVKGSQVLVTVDPKFQTRGDAKTVWVDYHNITRV VAVGGRIYIDDGLISLVVQKIGPEGLVTEVEHGGI LGSRKGVNLPNTEVDLPGLSEQDLLDLRFGVQHNV DIIFASFVRKASDVLAVRDALGPEGQNIKIISKIE NHEGVKKFDEILEVSDGIMVARGDLGIEIPAEKVF LAQKMMIGRCNLAGKPVVCATQMLESMITKARPTR AETSDVANAVLDGADCIMLSGETAKGSFPVEAVMM QHAIAREAEAAVYHRQLFEELRRAAPLSRDPTEVT AIGAVEASFKCCAAAIIVLTKTGRSAQLLSQYRPR AAVIAVTRSAQAARQVHLSRGVFPLLYREPPEAIW ADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRP GSGYTNIMRVLSVS
Expression Region
1-574aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal 6xHis-tagged
MW
66.2 kDa
Alternative Name
L-PKPyruvate kinase isozymes L/R
Relevance
Plays a key role in glycolysis.
Reference
The L- and R-type isozymes of rat pyruvate kinase are produced from a single gene by use of different promoters.Noguchi T., Yamada K., Inoue H., Matsuda T., Tanaka T.J. Biol. Chem. 262:14366-14371(1987)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Plays a key role in glycolysis.
Protein Families
Pyruvate kinase family
Amount: 50ug
Available: In stock
Listprice: €350.03
Price: €350.03
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close