Comparison

Recombinant Human Tissue-type plasminogen activator(PLAT),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP018120HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
INN: AlteplaseINN: Reteplase
AA Sequence
SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCW CNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSD FVCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWS TAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGN HNYCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSE GNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILI GKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHV LKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGL FADIASHPWQAAIFAKHRRSPGERFLCGGILISSC WILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQ KFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCA QESSVVRTVCLPPADLQLPDWTECELSGYGKHEAL SPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNM LCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRM TLVGIISWGLGCGQKDVPGVYTKVTNYLDWI
Research Topic
Cancer
Uniprot ID
P00750
Gene Names
PLAT
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
36-556aa
MW of Fusion Proten
74, 3
Sequence Info
Partial
Relevance
Converts the abundant, but inactive, zymogen plasminogen to plasmin by hydrolyzing a single Arg-Val bond in plasminogen. By controlling plasmin-mediated proteolysis, it plays an important role in tissue rodeling and degradation, in cell migration and many other physiopathological events. Plays a direct role in facilitating neuronal migration.
Reference
Cloning and expression of human tissue-type plasminogen activator cDNA in E. coli.Pennica D., Holmes W.E., Kohr W.J., Harkins R.N., Vehar G.A., Ward C.A., Bennett W.F., Yelverton E., Seeburg P.H., Heyneker H.L., Goeddel D.V., Collen D.Nature 301:214-221(1983)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close