Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
100ug |
Host |
E.coli |
Item no. |
CSB-EP018120HU(A5)-100 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Areas |
Cancer |
Uniprot ID |
P00750 |
Gene Names |
PLAT |
Organism |
Homo sapiens (Human) |
AA Sequence |
GLFADIASHPWQAAIFAKHRRSPGERFLCGGILIS SCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEE EQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSR CAQESSVVRTVCLPPADLQLPDWTECELSGYGKHE ALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTD NMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDG RMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWI |
Expression Region |
314-556aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
43.1 kDa |
Alternative Name(s) |
INN: AlteplaseINN: Reteplase |
Relevance |
Converts the abundant, but inactive, zymogen plasminogen to plasmin by hydrolyzing a single Arg-Val bond in plasminogen. By controlling plasmin-mediated proteolysis, it plays an important role in tissue rodeling and degradation, in cell migration and many other physiopathological events. Plays a direct role in facilitating neuronal migration. |
Reference |
Cloning and expression of human tissue-type plasminogen activator cDNA in E. coli.Pennica D., Holmes W.E., Kohr W.J., Harkins R.N., Vehar G.A., Ward C.A., Bennett W.F., Yelverton E., Seeburg P.H., Heyneker H.L., Goeddel D.V., Collen D.Nature 301:214-221(1983) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Converts the abundant, but inactive, zymogen plasminogen to plasmin by hydrolyzing a single Arg-Val bond in plasminogen. By controlling plasmin-mediated proteolysis, it plays an important role in tissue remodeling and degradation, in cell migration and many other physiopathological events. Plays a direct role in facilitating neuronal migration. |
Involvement in disease |
Increased activity of TPA results in increased fibrinolysis of fibrin blood clots that is associated with excessive bleeding. Defective release of TPA results in hypofibrinolysis that can lead to thrombosis or embolism. |
Subcellular Location |
Secreted, extracellular space |
Protein Families |
Peptidase S1 family |
Tissue Specificity |
Synthesized in numerous tissues (including tumors) and secreted into most extracellular body fluids, such as plasma, uterine fluid, saliva, gingival crevicular fluid, tears, seminal fluid, and milk. |
Paythway |
Complementandcoagulationcascades |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.